Integrin alpha 4/CD49d Rabbit anti-Human, Mouse, Rat, Clone: 8M8C2, Novus Biologicals™

Rabbit Monoclonal Antibody

Supplier:  Novus Biologicals NBP31632220UL

Catalog No. NB167736

Description

Integrin alpha 4/CD49d Monoclonal antibody specifically detects Integrin alpha 4/CD49d in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Integrin alpha 4/CD49d
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
• Clone: 8M8C2
• Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin
• Gene Alias: 269C wild type, CD49 antigen-like family member D, CD49d, CD49d antigen, CD49Dantigen CD49D, alpha-4 subunit of VLA-4 receptor, IA4, integrin alpha 4, integrin alpha-4, integrin alpha-4 subunit, Integrin alpha-IV, integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor), MGC90518, very late activation protein 4 receptor, alpha 4 subunit, VLA-4 subunit alpha
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 933-1032 of human Integrin alpha 4/CD49d (P13612). ALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKRYFTIVIISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRDSWSYINSKSNDD
• Quantity: 20 μg
• Research Discipline: Cancer, Cell Biology, Cellular Markers, Cytokine Research, Growth and Development, Lysosome Markers, Mast Cell Markers, Membrane Trafficking and Chaperones, Microautophagy, Neuronal Cell Markers
• Gene ID (Entrez): 3676
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG