Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Integrin alpha 4/CD49d Rabbit anti-Human, Mouse, Rat, Clone: 8M8C2, Novus Biologicals™

Rabbit Monoclonal Antibody
$205.50 - $492.50
Specifications
Antigen | Integrin alpha 4/CD49d |
---|---|
Clone | 8M8C2 |
Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin |
Applications | Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin) |
Classification | Monoclonal |
Description
Integrin alpha 4/CD49d Monoclonal antibody specifically detects Integrin alpha 4/CD49d in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)Specifications
Integrin alpha 4/CD49d | |
Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin | |
Monoclonal | |
Purified | |
RUO | |
Human, Mouse, Rat | |
269C wild type, CD49 antigen-like family member D, CD49d, CD49d antigen, CD49Dantigen CD49D, alpha-4 subunit of VLA-4 receptor, IA4, integrin alpha 4, integrin alpha-4, integrin alpha-4 subunit, Integrin alpha-IV, integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor), MGC90518, very late activation protein 4 receptor, alpha 4 subunit, VLA-4 subunit alpha | |
A synthetic peptide corresponding to a sequence within amino acids 933-1032 of human Integrin alpha 4/CD49d (P13612). ALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKRYFTIVIISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRDSWSYINSKSNDD | |
Primary | |
Store at -20°C. Avoid freeze-thaw cycles. |
8M8C2 | |
Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Cancer, Cell Biology, Cellular Markers, Cytokine Research, Growth and Development, Lysosome Markers, Mast Cell Markers, Membrane Trafficking and Chaperones, Microautophagy, Neuronal Cell Markers | |
PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
3676 | |
IgG | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title