Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Integrin alpha 5/CD49e Antibody (CL6940), Novus Biologicals™
SDP

Catalog No. NBP276518 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP276518 100 μL
NB392749 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP276518 Supplier Novus Biologicals Supplier No. NBP276518
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

Integrin alpha 5/CD49e Monoclonal specifically detects Integrin alpha 5/CD49e in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen Integrin alpha 5/CD49e
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
Classification Monoclonal
Clone CL6940
Conjugate Unconjugated
Dilution Western Blot 1.0 μg/mL, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Knockdown Validated
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Alias CD49 antigen-like family member E, CD49e, CD49e antigen, Fibronectin receptor subunit alpha, fibronectin receptor, alpha subunit, FNRAVLA5A, integrin alpha-5, Integrin alpha-F, integrin, alpha 5 (fibronectin receptor, alpha polypeptide), very late activation protein 5, alpha subunit, VLA-5
Gene Symbols ITGA5
Host Species Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: DQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWA
Purification Method Protein A purified
Quantity 100 μL
Primary or Secondary Primary
Gene ID (Entrez) 3678.0
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.