Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Integrin alpha 8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | Integrin alpha 8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15994020
|
Novus Biologicals
NBP15994020UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP159940
|
Novus Biologicals
NBP159940 |
100 μL |
Each for $487.50
|
|
|||||
Description
Integrin alpha 8 Polyclonal specifically detects Integrin alpha 8 in Human samples. It is validated for Western Blot.Specifications
| Integrin alpha 8 | |
| Polyclonal | |
| Rabbit | |
| P53708 | |
| 8516 | |
| Synthetic peptides corresponding to ITGA8(integrin, alpha 8) The peptide sequence was selected from the N terminal of ITGA8. Peptide sequence GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| integrin alpha-8, integrin, alpha 8 | |
| ITGA8 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title