Learn More
Description
Specifications
Specifications
| Antigen | Integrin beta 1/CD29 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | CD29, CD29 antigen, Fibronectin receptor subunit beta, FNRBVLAB, GPIIA, integrin beta-1, integrin VLA-4 beta subunit, integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includesMDF2, MSK12), MDF2, MSK12, very late activation protein, beta polypeptide, VLA-4 subunit beta, VLA-BETA |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNE |
| Purification Method | Protein A purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
