Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Integrin beta 1/CD29 Antibody, Novus Biologicals™
SDP

Catalog No. NB393057 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB393057 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB393057 Supplier Novus Biologicals Supplier No. NBP26266025UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Integrin beta 1/CD29 Polyclonal antibody specifically detects Integrin beta 1/CD29 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen Integrin beta 1/CD29
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias CD29, CD29 antigen, Fibronectin receptor subunit beta, FNRBVLAB, GPIIA, integrin beta-1, integrin VLA-4 beta subunit, integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includesMDF2, MSK12), MDF2, MSK12, very late activation protein, beta polypeptide, VLA-4 subunit beta, VLA-BETA
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: FQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNE
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Cell Biology, Cellular Markers, Cytokine Research, Immunology, Mesenchymal Stem Cell Markers, Neuronal Cell Markers, Signal Transduction, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 3688
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.