Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Integrin beta 3/CD61 Antibody (CL7319), Novus Biologicals™
SDP

Catalog No. NBP276484 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP276484 100 μL
NB392758 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP276484 Supplier Novus Biologicals Supplier No. NBP276484
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

Integrin beta 3/CD61 Monoclonal specifically detects Integrin beta 3/CD61 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Integrin beta 3/CD61
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL7319
Conjugate Unconjugated
Dilution Western Blot 1 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Alias CD61, CD61 antigen, GP3Aplatelet glycoprotein IIIa, GPIIIaintegrin beta-3, integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61), ITG B3, Platelet membrane glycoprotein IIIa
Gene Symbols ITGB3
Host Species Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: VRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGP
Purification Method Protein A purified
Quantity 100 μL
Research Discipline Cancer, Cytoskeleton Markers, Phospho Specific, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 3690.0
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.