integrin beta 4 binding protein Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP213954	0.1 mL

Catalog No. NBP213954 Supplier Novus Biologicals Supplier No. NBP213954

Description

Rabbit Polyclonal Antibody

integrin beta 4 binding protein Polyclonal specifically detects integrin beta 4 binding protein in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: integrin beta 4 binding protein
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: b(2)gcn, B(2)GCN homolog, B4 integrin interactor, CAB, EIF3Ap27(BBP), eIF-6, eukaryotic translation initiation factor 3A, eukaryotic translation initiation factor 6, ITGB4BPintegrin beta 4 binding protein, p27 beta-4 integrin-binding protein, p27BBP
• Gene Symbols: EIF6
• Host Species: Rabbit
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP
• Purification Method: Affinity Purified
• Quantity: 0.1 mL
• Regulatory Status: RUO
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Primary or Secondary: Primary
• Gene ID (Entrez): 3692
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only