Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Integrin beta 8 Antibody (CL7290), Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP27648025UL
Description
Integrin beta 8 Monoclonal specifically detects Integrin beta 8 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
Integrin beta 8 | |
Monoclonal | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
ITGB8 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: AQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHY | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
IgG1 |
ELISA, Immunohistochemistry, Immunofluorescence | |
CL7290 | |
Western Blot 1 μg/mL, Immunocytochemistry/Immunofluorescence 2-10 μg/mL | |
integrin beta-8, integrin, beta 8 | |
Mouse | |
25 μL | |
3696 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction