Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Integrin beta 8 Antibody (CL7290), Novus Biologicals™

Mouse Monoclonal Antibody

$382.00 - $646.00

Specifications

Antigen	Integrin beta 8
Clone	CL7290
Classification	Monoclonal
Conjugate	Unconjugated
Host Species	Mouse

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP276480 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP276480	100 μL	Each for $646.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB402778 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP27648025UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Integrin beta 8 Monoclonal specifically detects Integrin beta 8 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	Integrin beta 8
Classification	Monoclonal
Host Species	Mouse
Gene Alias	integrin beta-8, integrin, beta 8
Gene Symbols	ITGB8
Isotype	IgG1
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Clone	CL7290
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene ID (Entrez)	3696
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: AQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHY
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Integrin beta 8 Antibody (CL7290), Novus Biologicals™

Specifications

Description

Specifications

Documents