Integrin beta 8 Antibody (CL7290), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP276480

Catalog No. NBP276480

Description

Integrin beta 8 Monoclonal specifically detects Integrin beta 8 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Integrin beta 8
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
• Gene Symbols: ITGB8
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHY
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Clone: CL7290
• Dilution: Western Blot 1 ug/ml, Immunocytochemistry/Immunofluorescence 2-10 ug/ml
• Gene Alias: integrin beta-8, integrin, beta 8
• Host Species: Mouse
• Quantity: 100 μL
• Gene ID (Entrez): 3696
• Target Species: Human
• Isotype: IgG1