Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. IQCF1 Antibody, Novus Biologicals™

IQCF1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16008720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16008720 20 μL
NBP160087 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16008720 Supplier Novus Biologicals Supplier No. NBP16008720UL

Description

Rabbit Polyclonal Antibody

IQCF1 Polyclonal specifically detects IQCF1 in Human samples. It is validated for Western Blot.

Specifications

Antigen IQCF1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8N6M8
Gene Alias FLJ27508, IQ domain-containing protein F1, IQ motif containing F1, MGC39725
Gene Symbols IQCF1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to IQCF1(IQ motif containing F1) The peptide sequence was selected from the middle region of IQCF1. Peptide sequence ATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAF.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 132141
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.