Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IQCF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | IQCF1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16008720
|
Novus Biologicals
NBP16008720UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP160087
|
Novus Biologicals
NBP160087 |
100 μL |
Each for $487.50
|
|
|||||
Description
IQCF1 Polyclonal specifically detects IQCF1 in Human samples. It is validated for Western Blot.Specifications
| IQCF1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ27508, IQ domain-containing protein F1, IQ motif containing F1, MGC39725 | |
| IQCF1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8N6M8 | |
| 132141 | |
| Synthetic peptides corresponding to IQCF1(IQ motif containing F1) The peptide sequence was selected from the middle region of IQCF1. Peptide sequence ATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAF. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title