IRP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24957625UL

Catalog No. NB395622

Description

IRP2 Polyclonal antibody specifically detects IRP2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: IRP2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: ACO3, EC 4.2.1.3, FLJ23381, IRE-BP 2, Iron regulatory protein 2, iron-responsive element binding protein 2, iron-responsive element-binding protein 2, IRP2IRP2AD
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EYGAILSFFPVDNVTLKHLEHTGFSKAKLESMETYLKAVKLFRNDQNSSGEPEYSQVIQINLNSIVPSVSGP
• Quantity: 25 μL
• Research Discipline: HIF Target Genes, Hypoxia, Lipid and Metabolism
• Gene ID (Entrez): 3658
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified