Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IRP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | IRP2 |
---|---|
Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
IRP2 Polyclonal antibody specifically detects IRP2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
IRP2 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
HIF Target Genes, Hypoxia, Lipid and Metabolism | |
PBS (pH 7.2), 40% Glycerol | |
3658 | |
IgG | |
Immunogen affinity purified |
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
ACO3, EC 4.2.1.3, FLJ23381, IRE-BP 2, Iron regulatory protein 2, iron-responsive element binding protein 2, iron-responsive element-binding protein 2, IRP2IRP2AD | |
This antibody was developed against a recombinant protein corresponding to amino acids: EYGAILSFFPVDNVTLKHLEHTGFSKAKLESMETYLKAVKLFRNDQNSSGEPEYSQVIQINLNSIVPSVSGP | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title