Isoleucyl tRNA synthetase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15535720UL

Catalog No. NBP15535720

Description

Isoleucyl tRNA synthetase Polyclonal specifically detects Isoleucyl tRNA synthetase in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Isoleucyl tRNA synthetase
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: P41252
• Gene Symbols: IARS
• Immunogen: Synthetic peptides corresponding to IARS(isoleucyl-tRNA synthetase) The peptide sequence was selected from the middle region of IARS. Peptide sequence YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 6.1.1, EC 6.1.1.5, FLJ20736, IARS1, ILERS, ILRS, IRS, isoleucine tRNA ligase 1, cytoplasmic, Isoleucine--tRNA ligase, isoleucyl-tRNA synthetase, isoleucyl-tRNA synthetase, cytoplasmic, PRO0785
• Host Species: Rabbit
• Molecular Weight of Antigen: 144 kDa
• Quantity: 20 μL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 3376
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.