Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Isoleucyl tRNA synthetase Antibody, Novus Biologicals™
SDP

Catalog No. NBP15535720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15535720 20 μL
NBP155357 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15535720 Supplier Novus Biologicals Supplier No. NBP15535720UL

Rabbit Polyclonal Antibody

Isoleucyl tRNA synthetase Polyclonal specifically detects Isoleucyl tRNA synthetase in Human samples. It is validated for Western Blot.

Specifications

Antigen Isoleucyl tRNA synthetase
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P41252
Gene Alias EC 6.1.1, EC 6.1.1.5, FLJ20736, IARS1, ILERS, ILRS, IRS, isoleucine tRNA ligase 1, cytoplasmic, Isoleucine--tRNA ligase, isoleucyl-tRNA synthetase, isoleucyl-tRNA synthetase, cytoplasmic, PRO0785
Gene Symbols IARS
Host Species Rabbit
Immunogen Synthetic peptides corresponding to IARS(isoleucyl-tRNA synthetase) The peptide sequence was selected from the middle region of IARS. Peptide sequence YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD.
Molecular Weight of Antigen 144 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 3376
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.