Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Isoleucyl tRNA synthetase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Isoleucyl tRNA synthetase |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15535720
|
Novus Biologicals
NBP15535720UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP155357
|
Novus Biologicals
NBP155357 |
100 μL |
Each for $487.50
|
|
|||||
Description
Isoleucyl tRNA synthetase Polyclonal specifically detects Isoleucyl tRNA synthetase in Human samples. It is validated for Western Blot.Specifications
| Isoleucyl tRNA synthetase | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| EC 6.1.1, EC 6.1.1.5, FLJ20736, IARS1, ILERS, ILRS, IRS, isoleucine tRNA ligase 1, cytoplasmic, Isoleucine--tRNA ligase, isoleucyl-tRNA synthetase, isoleucyl-tRNA synthetase, cytoplasmic, PRO0785 | |
| IARS | |
| IgG | |
| 144 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P41252 | |
| 3376 | |
| Synthetic peptides corresponding to IARS(isoleucyl-tRNA synthetase) The peptide sequence was selected from the middle region of IARS. Peptide sequence YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title