Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Isoleucyl tRNA synthetase Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | Isoleucyl tRNA synthetase |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15535720
|
Novus Biologicals
NBP15535720UL |
20 μL |
Each for $152.22
|
|
NBP155357
|
Novus Biologicals
NBP155357 |
100 μL |
Each for $436.00
|
|
Description
Isoleucyl tRNA synthetase Polyclonal specifically detects Isoleucyl tRNA synthetase in Human samples. It is validated for Western Blot.Specifications
| Isoleucyl tRNA synthetase | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| P41252 | |
| 3376 | |
| Synthetic peptides corresponding to IARS(isoleucyl-tRNA synthetase) The peptide sequence was selected from the middle region of IARS. Peptide sequence YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 6.1.1, EC 6.1.1.5, FLJ20736, IARS1, ILERS, ILRS, IRS, isoleucine tRNA ligase 1, cytoplasmic, Isoleucine--tRNA ligase, isoleucyl-tRNA synthetase, isoleucyl-tRNA synthetase, cytoplasmic, PRO0785 | |
| IARS | |
| IgG | |
| Affinity Purified | |
| 144 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title