Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ISYNA1 Antibody, Novus Biologicals™

ISYNA1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15498420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15498420 20 μL
NBP154984 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15498420 Supplier Novus Biologicals Supplier No. NBP15498420UL

Description

Rabbit Polyclonal Antibody

ISYNA1 Polyclonal specifically detects ISYNA1 in Human samples. It is validated for Western Blot.

Specifications

Antigen ISYNA1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9NPH2
Gene Alias EC 5.5.1.4, hINO1, hIPS, INO1, INOS, inositol-3-phosphate synthase 1, IPSIPS 1, MI-1-P synthase, MIP synthase, Myo-inositol 1-phosphate synthase A1, Myo-inositol-1-phosphate synthase
Gene Symbols ISYNA1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ISYNA1(myo-inositol 1-phosphate synthase A1) The peptide sequence was selected from the N terminal of ISYNA1. Peptide sequence LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD.
Molecular Weight of Antigen 61 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Apoptosis
Primary or Secondary Primary
Gene ID (Entrez) 51477
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.