Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ITGB1BP3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP153033 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP153033 100 μL
NBP15303320 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP153033 Supplier Novus Biologicals Supplier No. NBP153033
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

ITGB1BP3 Polyclonal specifically detects ITGB1BP3 in Human samples. It is validated for Western Blot.

Specifications

Antigen ITGB1BP3
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9NPI5
Gene Alias EC 2.7.1.22, EC 2.7.1.n4, integrin beta 1 binding protein 3, Integrin beta-1-binding protein 3, MGC126624, MIBPNRK 2, Muscle integrin-binding protein, muscle-specific beta 1 integrin binding protein, nicotinamide riboside kinase 2, Nicotinic acid riboside kinase 2, NmR-K 2, NRK2RNK 2, Ribosylnicotinamide kinase 2, Ribosylnicotinic acid kinase 2
Gene Symbols NMRK2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ITGB1BP3(integrin beta 1 binding protein 3) The peptide sequence was selected from the middle region of ITGB1BP3. Peptide sequence YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer, Cytokine Research, Cytoskeleton Markers, Embryonic Stem Cell Markers, Immunology, Mesenchymal Stem Cell Markers, Neuronal Cell Markers, Neuronal Stem Cell Markers, Signal Transduction, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 27231
Test Specificity Expected identity based on immunogen sequence: Human: 100%; Xenopus: 92%; Chicken: 92%; Zebrafish: 92%; Bovine: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Rat, Pig, Bovine, Equine, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.