ITGB1BP3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15303320UL

Catalog No. NBP15303320

Description

ITGB1BP3 Polyclonal specifically detects ITGB1BP3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ITGB1BP3
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q9NPI5
• Gene Symbols: NMRK2
• Immunogen: Synthetic peptides corresponding to ITGB1BP3(integrin beta 1 binding protein 3) The peptide sequence was selected from the middle region of ITGB1BP3. Peptide sequence YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY.
• Quantity: 20 μL
• Research Discipline: Cancer, Cytokine Research, Cytoskeleton Markers, Embryonic Stem Cell Markers, Immunology, Mesenchymal Stem Cell Markers, Neuronal Cell Markers, Neuronal Stem Cell Markers, Signal Transduction, Stem Cell Markers
• Gene ID (Entrez): 27231
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with No Preservative
• Gene Alias: EC 2.7.1.22, EC 2.7.1.n4, integrin beta 1 binding protein 3, Integrin beta-1-binding protein 3, MGC126624, MIBPNRK 2, Muscle integrin-binding protein, muscle-specific beta 1 integrin binding protein, nicotinamide riboside kinase 2, Nicotinic acid riboside kinase 2, NmR-K 2, NRK2RNK 2, Ribosylnicotinamide kinase 2, Ribosylnicotinic acid kinase 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG