Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ITIH4 Antibody (CL1858), Novus Biologicals™

ITIH4 Antibody (CL1858), Novus Biologicals™
SDP

Catalog No. NBP234492 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP234492 0.1 mL
NB397202 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP234492 Supplier Novus Biologicals Supplier No. NBP234492
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody has been used in 1 publication

ITIH4 Monoclonal specifically detects ITIH4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Specifications

Antigen ITIH4
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Classification Monoclonal
Clone CL1858
Conjugate Unconjugated
Dilution Western Blot 1 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000, Immunohistochemistry-Frozen
Gene Accession No. Q14624
Gene Alias DKFZp686G21125, H4P, heavy chain-like, 1, IHRP, inter-alpha (globulin) inhibitor H4 (plasma Kallikrein-sensitive glycoprotein), inter-alpha-trypsin inhibitor family heavy chain-related protein, inter-alpha-trypsin inhibitor heavy chain H4, ITI-HC4, ITIHL1, PK-120, plasma kallikrein-sensitive glycoprotein 120, PRO1851
Gene Symbols ITIH4
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESRNRNVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFRRLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPA
Purification Method Protein A purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3700
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.