Learn More
Description
Specifications
Specifications
| Antigen | ITPA |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | C20orf37, dJ794I6.3, EC 3.6.1, EC 3.6.1.19, HLC14-06-P, Inosine triphosphatase, inosine triphosphatase (nucleoside triphosphate pyrophosphatase), inosine triphosphatase-A, inosine triphosphate pyrophosphatase, inosine triphosphate pyrophosphohydrolase, ITPase, My049 protein, nucleoside triphosphate diphosphatase, Putative oncogene protein hlc14-06-p |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GNAKKLEEVVQILGDKFPCTLVAQKIDLPEYQGEPDEISIQKCQEAVRQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQL |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
