IZUMO4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23088125UL

Catalog No. NB437365

Description

IZUMO4 Polyclonal specifically detects IZUMO4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: IZUMO4
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: Q1ZYL8
• Gene Symbols: IZUMO4
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RCGIFQYETISCNNCTDSHVACFGYNCESSAQWKSAVQGLLNYINNWHKQDTSMSLVSPALRCLEPPHLANLTLEDAAEC
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C19orf36, chromosome 19 open reading frame 36, IMAGE:4215339, IZUMO family member 4, izumo sperm-egg fusion protein 4, putative SAMP14 binding protein variant 1, putative SAMP14 binding protein variant 2, Sperm 22 kDa protein c113
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 113177
• Target Species: Human
• Isotype: IgG

For Research Use Only