JAKMIP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157249

Catalog No. NBP157249

Description

JAKMIP1 Polyclonal specifically detects JAKMIP1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: JAKMIP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: JAKMIP1
• Immunogen: Synthetic peptides corresponding to JAKMIP1(janus kinase and microtubule interacting protein 1) The peptide sequence was selected from the middle region of JAKMIP1. Peptide sequence FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Guinea pig: 92%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: FLJ31564, GABA-B receptor-binding protein, GABABRBP, JAMIP1Jak and microtubule interacting protein 1, janus kinase and microtubule interacting protein 1, marlin-1, MARLIN1janus kinase and microtubule-interacting protein 1, Multiple alpha-helices and RNA-linker protein 1, multiple coiled-coil GABABR1-binding protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 152789
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.