Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
JAKMIP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | JAKMIP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
JAKMIP1 Polyclonal specifically detects JAKMIP1 in Human samples. It is validated for Western Blot.Specifications
JAKMIP1 | |
Polyclonal | |
Rabbit | |
FLJ31564, GABA-B receptor-binding protein, GABABRBP, JAMIP1Jak and microtubule interacting protein 1, janus kinase and microtubule interacting protein 1, marlin-1, MARLIN1janus kinase and microtubule-interacting protein 1, Multiple alpha-helices and RNA-linker protein 1, multiple coiled-coil GABABR1-binding protein | |
JAKMIP1 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
152789 | |
Synthetic peptides corresponding to JAKMIP1(janus kinase and microtubule interacting protein 1) The peptide sequence was selected from the middle region of JAKMIP1. Peptide sequence FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title