JAM-4/IGSF5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23415525UL

Catalog No. NB397241

Description

JAM-4/IGSF5 Polyclonal specifically detects JAM-4/IGSF5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: JAM-4/IGSF5
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Accession No.: Q9NSI5
• Gene Symbols: IGSF5
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RGFRIQFQKKSEKEKTNKETETESGNENSGYNSDEQKTTDTASLPPKSCESSDPEQRNSSCGPPHQRADQRPPRPASHPQASFNLASPEKVSNTT
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: GSF5, IgSF5, Immunoglobulin Superfamily 5 Like, Immunoglobulin Superfamily Member 5, Immunoglobulin Superfamily, Member 5, JAM4, JAM-4, Junctional Adhesion Molecule 4, Putative Gene, Immunoglobulin Superfamily 5 Like11
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 150084
• Target Species: Human
• Isotype: IgG

For Research Use Only