JAMP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257393

Catalog No. NBP257393

Description

JAMP Polyclonal specifically detects JAMP in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: JAMP
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: C14orf100, chromosome 14 open reading frame 100, HSPC213, HSPC327, JAMPCDA06, JNK1/MAPK8-associated membrane protein, JNK1-associated membrane protein, JNK-associated membrane protein, Jun N-terminal kinase 1-associated membrane protein, Medulloblastoma antigen MU-MB-50.4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: JKAMP
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TFRRPMAVDIQPACLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPELYD
• Quantity: 100 μL
• Research Discipline: Unfolded Protein Response (UPR)
• Gene ID (Entrez): 51528
• Target Species: Human
• Isotype: IgG

For Research Use Only