Learn More
Description
Specifications
Specifications
| Antigen | JMJD2B |
| Applications | Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | EC 1.14.11, FLJ44906, JHDM3B, JmjC domain-containing histone demethylation protein 3B, JMJD2BEC 1.14.11.-, jumonji domain containing 2B, Jumonji domain-containing protein 2B, KIAA0876lysine-specific demethylase 4B, lysine (K)-specific demethylase 4B |
| Host Species | Rabbit |
| Immunogen | This antibody has been engineered to specifically recognize the recombinant protein JMJD2B using the following amino acid sequence: SRLSLSTGAPQEPAFSGEEAKAAKRPRVGTPLATEDSGRSQDYVAFVESLLQVQG |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
