Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
JMJD2D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00
Specifications
| Antigen | JMJD2D |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
JMJD2D Polyclonal antibody specifically detects JMJD2D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| JMJD2D | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Transcription Factors and Regulators | |
| PBS (pH 7.2), 40% Glycerol | |
| 55693 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 1.14.11, EC 1.14.11.-, FLJ10251, JHDM3D, JmjC domain-containing histone demethylation protein 3D, JMJD2Dlysine-specific demethylase 4D, jumonji domain containing 2D, Jumonji domain-containing protein 2D, lysine (K)-specific demethylase 4D, MGC141909 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PLLAGTTCTASGPEPEPLPEDGALMDKPVPLSPGLQHPVKASGCSWAPV | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title