Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. JMJD6/PSR Rabbit anti-Human, Polyclonal, Novus Biologicals™

JMJD6/PSR Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB126725 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB126725 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB126725 Supplier Novus Biologicals Supplier No. NBP310913100UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

JMJD6/PSR Polyclonal specifically detects JMJD6/PSR in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

Antigen JMJD6/PSR
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Formulation PBS buffer, 2% sucrose
Gene Alias bifunctional arginine demethylase and lysyl-hydroxylase JMJD6, EC 1.14.11, EC 1.14.11.-, Histone arginine demethylase JMJD6, JmjC domain-containing protein 6, jumonji domain containing 6, Jumonji domain-containing protein 6, KIAA0585PSR, Lysyl-hydroxylase JMJD6, Peptide-lysine 5-dioxygenase JMJD6, Phosphatidylserine receptorPTDSR, Protein PTDSR, PTDSR1
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human JMJD6/PSR (NP_055982). Peptide sequence PRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGE
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Epigenetics, Stem Cell Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 23210
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.