JWA Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP309996100UL

Catalog No. NB124893

Description

JWA Polyclonal specifically detects JWA in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: JWA
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: ADP-ribosylation factor-like protein 6-interacting protein 5, ADP-ribosylation-like factor 6 interacting protein 5, Aip-5, ARL-6-interacting protein 5, Cytoskeleton-related vitamin A-responsive protein, Dermal papilla-derived protein 11, DERP11addicsin, Glutamate transporter EAAC1-interacting protein, glutamate transporter EEAC1-associated protein, GTRAP3-18aip-5, hp22, HSPC127, JM5, jmx, JWAcytoskeleton related vitamin A responsive protein, PRA1 domain family 3, PRA1 family protein 3, PRA2, PRAF3dermal papilla derived protein 11, Prenylated Rab acceptor protein 2, Protein JWa, putative MAPK activating protein PM27, Putative MAPK-activating protein PM27
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human JWA (NP_075368.1). Peptide sequence MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVV
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10550
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.