Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
JWA Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | JWA |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
JWA Polyclonal specifically detects JWA in Mouse samples. It is validated for Western Blot.Specifications
JWA | |
Western Blot | |
Unconjugated | |
Rabbit | |
Mouse | |
ADP-ribosylation factor-like protein 6-interacting protein 5, ADP-ribosylation-like factor 6 interacting protein 5, Aip-5, ARL-6-interacting protein 5, Cytoskeleton-related vitamin A-responsive protein, Dermal papilla-derived protein 11, DERP11addicsin, Glutamate transporter EAAC1-interacting protein, glutamate transporter EEAC1-associated protein, GTRAP3-18aip-5, hp22, HSPC127, JM5, jmx, JWAcytoskeleton related vitamin A responsive protein, PRA1 domain family 3, PRA1 family protein 3, PRA2, PRAF3dermal papilla derived protein 11, Prenylated Rab acceptor protein 2, Protein JWa, putative MAPK activating protein PM27, Putative MAPK-activating protein PM27 | |
The immunogen is a synthetic peptide directed towards the N terminal region of human JWA (NP_075368.1). Peptide sequence MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVV | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
10550 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title