Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KA2/GRIK5/Glutamate Receptor KA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | KA2/GRIK5/Glutamate Receptor KA2 |
---|---|
Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
Applications | Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
KA2/GRIK5/Glutamate Receptor KA2 Polyclonal antibody specifically detects KA2/GRIK5/Glutamate Receptor KA2 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
KA2/GRIK5/Glutamate Receptor KA2 | |
Immunofluorescence | |
Unconjugated | |
Rabbit | |
Neuroscience | |
PBS (pH 7.2) and 40% Glycerol | |
2901 | |
IgG | |
Protein A purified |
Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
Polyclonal | |
Purified | |
RUO | |
Human | |
EAA2, Excitatory amino acid receptor 2, glutamate receptor KA2, Glutamate receptor KA-2, glutamate receptor, ionotropic kainate 5, glutamate receptor, ionotropic, kainate 5, KA2GRIK2 | |
This antibody was developed against a recombinant protein corresponding to amino acids: KVSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTY | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title