Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Kanadaptin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | Kanadaptin |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Kanadaptin Polyclonal specifically detects Kanadaptin in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Kanadaptin | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9BWU0 | |
| 22950 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TWGMGEDAVEDDAEENPIVLEFQQEREAFYIKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHSGKK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FLJ10624, FLJ41004, HLC3, HLC-3, Human lung cancer oncogene 3 protein, kanadaptin, Kidney anion exchanger adapter protein, kidney anion exchanger adaptor protein, lung cancer oncogene 3, MGC120646, MGC120648, solute carrier family 4 (anion exchanger), member 1, adapter protein, solute carrier family 4 (anion exchanger), member 1, adaptor protein, Solute carrier family 4 anion exchanger member 1 adapter protein | |
| SLC4A1AP | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title