Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KANK3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15693320UL
Description
KANK3 Polyclonal specifically detects KANK3 in Human samples. It is validated for Western Blot.Specifications
KANK3 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q6NY19-2 | |
KANK3 | |
Synthetic peptides corresponding to ANKRD47 The peptide sequence was selected from the N terminal of ANKRD47. Peptide sequence MAKFALNQNLPDLGGPRLCPVPAAGGARSPSSPYSVETPYGFHLDLDFLK. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ANKRD47, ankyrin repeat domain 47, Ankyrin repeat domain-containing protein 47, FLJ46061, kidney ankyrin repeat-containing protein 3, KN motif and ankyrin repeat domain-containing protein 3, KN motif and ankyrin repeat domains 3 | |
Rabbit | |
Affinity Purified | |
RUO | |
256949 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction