Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. KANK3 Antibody, Novus Biologicals™

KANK3 Antibody, Novus Biologicals™
SDP

Catalog No. NB438062 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB438062 25ul
NBP214138 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB438062 Supplier Novus Biologicals Supplier No. NBP21413825UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

KANK3 Polyclonal specifically detects KANK3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen KANK3
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50-1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias ANKRD47, ankyrin repeat domain 47, Ankyrin repeat domain-containing protein 47, FLJ46061, kidney ankyrin repeat-containing protein 3, KN motif and ankyrin repeat domain-containing protein 3, KN motif and ankyrin repeat domains 3
Gene Symbols KANK3
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: QLREATTQTPWSCAEKAAQTESPAEAPSLTQESSPGSMDGDRAVAPAGILKSIMK
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 256949
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.