Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KAP1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP239014 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP239014 0.1 mL
NB396564 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP239014 Supplier Novus Biologicals Supplier No. NBP239014
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

KAP1 Polyclonal specifically detects KAP1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen KAP1
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q13263
Gene Alias E3 SUMO-protein ligase TRIM28, EC 6.3.2.-, FLJ29029, KAP-1, KAP1KRAB-associated protein 1, KRIP-1, Nuclear corepressor KAP-1, RNF96KRAB-interacting protein 1, TF1B, TIF1-beta, TIF1BRING finger protein 96, transcription intermediary factor 1-beta, transcriptional intermediary factor 1-beta, tripartite motif containing 28, tripartite motif-containing 28, Tripartite motif-containing protein 28
Gene Symbols TRIM28
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: TDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLV
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Chromatin Research, DNA Repair, DNA replication Transcription Translation and Splicing, Protein Kinase, Signal Transduction, Transcription Factors and Regulators, Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 10155
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.