KAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP239014

Catalog No. NBP239014

Description

KAP1 Polyclonal specifically detects KAP1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: KAP1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: Q13263
• Gene Symbols: TRIM28
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLV
• Quantity: 0.1 mL
• Research Discipline: Chromatin Research, DNA Repair, DNA replication Transcription Translation and Splicing, Protein Kinase, Signal Transduction, Transcription Factors and Regulators, Zinc Finger
• Gene ID (Entrez): 10155
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: E3 SUMO-protein ligase TRIM28, EC 6.3.2.-, FLJ29029, KAP-1, KAP1KRAB-associated protein 1, KRIP-1, Nuclear corepressor KAP-1, RNF96KRAB-interacting protein 1, TF1B, TIF1-beta, TIF1BRING finger protein 96, transcription intermediary factor 1-beta, transcriptional intermediary factor 1-beta, tripartite motif containing 28, tripartite motif-containing 28, Tripartite motif-containing protein 28
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.