Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. KAT3B/p300 Antibody, Novus Biologicals™

KAT3B/p300 Antibody, Novus Biologicals™
SDP

Catalog No. NB405998 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB405998 25 μL
NBP187694 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB405998 Supplier Novus Biologicals Supplier No. NBP18769425UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

KAT3B/p300 Polyclonal specifically detects KAT3B/p300 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen KAT3B/p300
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200, Immunocytochemistry
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias E1A binding protein p300, E1A-associated protein p300, E1A-binding protein, 300kD, EC 2.3.1, EC 2.3.1.48, histone acetyltransferase p300, KAT3B, P300, p300 HAT, RSTS2
Gene Symbols EP300
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQ
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Adaptive Immunity, Alzheimers Research, Amino Acids Drugs and other small molecules, Angiogenesis, Apoptosis, Asthma, Astrocyte Markers, AU1 and AU5 Epitope Tags, Autophagy, Base Excision Repair, Beta Galactosidase Epitope Tags, Breast Cancer, Cancer, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, HIF Target Genes, Hypoxia, Stem Cell Markers, Transcription Factors and Regulators, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 2033
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.