KCC1/SLC12A4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158293

Catalog No. NBP158293

Description

KCC1/SLC12A4 Polyclonal specifically detects KCC1/SLC12A4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KCC1/SLC12A4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Electroneutral potassium-chloride cotransporter 1, Erythroid K-Cl cotransporter 1, FLJ17069, FLJ40489, hKCC1, KCC1erythroid K:Cl cotransporter, K-Cl cotransporter, potassium/chloride cotransporter 1, solute carrier family 12 (potassium/chloride transporters), member 4, solute carrier family 12 member 4
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6560
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UP95
• Gene Symbols: SLC12A4
• Immunogen: Synthetic peptides corresponding to SLC12A4(solute carrier family 12 (potassium/chloride transporters), member 4) The peptide sequence was selected from the N terminal of SLC12A4. Peptide sequence MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFL The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
• Isotype: IgG