Learn More
Description
Specifications
Specifications
| Antigen | KCC2/SLC12A5 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:100-1:2000 |
| Formulation | PBS and 2% Sucrose with 0.09% Sodium Azide |
| Gene Alias | Electroneutral potassium-chloride cotransporter 2, hKCC2, KCC2K-Cl cotransporter 2, KIAA1176erythroid K-Cl cotransporter 2, Neuronal K-Cl cotransporter, solute carrier family 12 (potassium/chloride transporter), member 5, solute carrier family 12 member 5 |
| Gene Symbols | SLC12A5 |
| Host Species | Rabbit |
| Immunogen | Synthetic peptides corresponding to the N terminal of Slc12a5. Immunizing peptide sequence TDCEDGDGGANPGDGNPKESSPFINSTDTEKGREYDGRNMALFEEEMDTS. |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
