Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KCMF1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP184283

 View more versions of this product

Catalog No. NBP184283


Only null left
Add to Cart

Description

Description

KCMF1 Polyclonal specifically detects KCMF1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

KCMF1
Polyclonal
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
DEBT91, DKFZp434L1021, EC 6.3.2, EC 6.3.2.-, FGF-induced in gastric cancer, FGF-induced ubiquitin-protein ligase in gastric cancers, FIGC, PCMFdifferentially expressed in branching tubulogenesis 91, Potassium channel modulatory factor, potassium channel modulatory factor 1, zinc finger, ZZ domain containing 1, ZZ-type zinc finger-containing protein 1, ZZZ1E3 ubiquitin-protein ligase KCMF1
Rabbit
Affinity Purified
RUO
56888
Human
IgG
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
KCMF1
This antibody was developed against Recombinant Protein corresponding to amino acids:MSETERQSMESERADRSLFVQELLLSTLVREESSSSDEDDRGEMADFGAMGCVDIMPLDVALENLNLKESNKGNEPPPPPL
0.1 mL
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.

For Research Use Only