KCMF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB432718	Novus Biologicals NBP18428325UL	25 μL
NBP184283	Novus Biologicals NBP184283	0.1 mL

Description

KCMF1 Polyclonal specifically detects KCMF1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: KCMF1
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: DEBT91, DKFZp434L1021, EC 6.3.2, EC 6.3.2.-, FGF-induced in gastric cancer, FGF-induced ubiquitin-protein ligase in gastric cancers, FIGC, PCMFdifferentially expressed in branching tubulogenesis 91, Potassium channel modulatory factor, potassium channel modulatory factor 1, zinc finger, ZZ domain containing 1, ZZ-type zinc finger-containing protein 1, ZZZ1E3 ubiquitin-protein ligase KCMF1
• Gene Symbols: KCMF1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 56888
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MSETERQSMESERADRSLFVQELLLSTLVREESSSSDEDDRGEMADFGAMGCVDIMPLDVALENLNLKESNKGNEPPPPPL
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only