KCNH1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25837625UL

Catalog No. NB393480

Description

KCNH1 Polyclonal specifically detects KCNH1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: KCNH1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: EAG channel 1, EAG1, EAGeag1, Ether-a-go-go potassium channel 1, ether-a-go-go, Drosophila, homolog of, hEAG1, h-eageag, Kv10.1, MGC142269, potassium channel, voltage-gated, subfamily H, member 1, potassium voltage-gated channel subfamily H member 1, potassium voltage-gated channel, subfamily H (eag-related), member 1, Voltage-gated potassium channel subunit Kv10.1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3756
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: KCNH1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DSCDSGITKSDLRLDNVGEARSPQDRSPILAEVKHSFYPIPEQTLQATVLEVRHELKEDIKALNAKMTNIEKQLSEILRILTSRRSSQSPQELFEISRPQSPES
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only