Learn More
Description
Specifications
Specifications
| Antigen | KCNH1 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | EAG channel 1, EAG1, EAGeag1, Ether-a-go-go potassium channel 1, ether-a-go-go, Drosophila, homolog of, hEAG1, h-eageag, Kv10.1, MGC142269, potassium channel, voltage-gated, subfamily H, member 1, potassium voltage-gated channel subfamily H member 1, potassium voltage-gated channel, subfamily H (eag-related), member 1, Voltage-gated potassium channel subunit Kv10.1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PGSECLGPKGGGGDCAKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKASGEATLKKTD |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
