Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KCNH1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31710325UL
This item is not returnable.
View return policy
Description
KCNH1 Polyclonal antibody specifically detects KCNH1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
KCNH1 | |
Polyclonal | |
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
EAG channel 1, EAG1, EAGeag1, Ether-a-go-go potassium channel 1, ether-a-go-go, Drosophila, homolog of, hEAG1, h-eageag, Kv10.1, MGC142269, potassium channel, voltage-gated, subfamily H, member 1, potassium voltage-gated channel subfamily H member 1, potassium voltage-gated channel, subfamily H (eag-related), member 1, Voltage-gated potassium channel subunit Kv10.1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: PGSECLGPKGGGGDCAKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKASGEATLKKTD | |
25 μg | |
Neuroscience | |
3756 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction