KCNJ1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications

Supplier:  Novus Biologicals NBP18287425UL

Catalog No. NB433298

Description

KCNJ1 Polyclonal specifically detects KCNJ1 in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: KCNJ1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P48048
• Gene Symbols: KCNJ1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:STSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETD
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3758
• Target Species: Human, Mouse, Rat
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ATP-regulated potassium channel ROM-K, ATP-sensitive inward rectifier potassium channel 1, inwardly rectifying K+ channel, Kir1.1, potassium inwardly-rectifying channel, subfamily J, member 1, ROMK1inwardly rectifying subfamily J member 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 45 kDa
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only