Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KCTD11 Antibody, Novus Biologicals™
SDP

Catalog No. NBP180211 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP180211 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP180211 Supplier Novus Biologicals Supplier No. NBP180211
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

KCTD11 Polyclonal specifically detects KCTD11 in Human samples. It is validated for Western Blot.

Specifications

Antigen KCTD11
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_001002914
Gene Alias BTB/POZ domain-containing protein KCTD11, C17orf36, chromosome 17 open reading frame 36, MGC129844, potassium channel tetramerisation domain containing 11, REn, REN/KCTD11, RENpotassium channel tetramerization domain containing 11, retinoic acid, EGF, NGF induced gene protein, retinoic acid, EGF, NGF induced gene/potassium channel tetramerization domaincontaining 11
Gene Symbols KCTD11
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human KCTD11. Peptide sequence ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPH The peptide sequence for this immunogen was taken from within the described region.
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 147040
Test Specificity Expected identity based on immunogen sequence: Human: 100%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.