Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. KHDRBS2 Antibody, Novus Biologicals™

KHDRBS2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15631720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15631720 20 μL
NBP156317 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15631720 Supplier Novus Biologicals Supplier No. NBP15631720UL

Description

Rabbit Polyclonal Antibody

KHDRBS2 Polyclonal specifically detects KHDRBS2 in Human samples. It is validated for Western Blot.

Specifications

Antigen KHDRBS2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q5VWX1
Gene Alias hSLM-1, KH domain containing, RNA binding, signal transduction associated 2, KH domain-containing, RNA-binding, signal transduction-associated protein 2, MGC26664, Sam68-like mammalian protein 1, SLM1bA535F17.1, SLM-1FLJ38664
Gene Symbols KHDRBS2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to KHDRBS2(KH domain containing, RNA binding, signal transduction associated 2) The peptide sequence was selected from the middle region of KHDRBS2. Peptide sequence EAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSE
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 202559
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.