Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KHDRBS3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP184774 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP184774 0.1 mL
NB432484 25ul
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP184774 Supplier Novus Biologicals Supplier No. NBP184774
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 2 publications

KHDRBS3 Polyclonal specifically detects KHDRBS3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen KHDRBS3
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias Etle, etoile, KH domain containing, RNA binding, signal transduction associated 3, SALPRNA-binding protein T-Star, Sam68-like mammalian protein 2, Sam68-like phosphotyrosine protein, Sam68-like phosphotyrosine protein, T-STAR, SLM-2KH domain-containing, RNA-binding, signal transduction-associated protein 3, SLM2TSTAR, T-STAR
Gene Symbols KHDRBS3
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GEGKDEEKYIDVVINKNMKLGQKVLIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARM
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10656
Test Specificity Specificity of human KHDRBS3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.