Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KIF12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | KIF12 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
KIF12 Polyclonal specifically detects KIF12 in Human samples. It is validated for Western Blot.Specifications
KIF12 | |
Polyclonal | |
Rabbit | |
B1ALC3 | |
113220 | |
Synthetic peptides corresponding to KIF12(kinesin family member 12) The peptide sequence was selected from the N terminal of KIF12. Peptide sequence SLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAH. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
kinesin family member 12, kinesin-like protein KIF12, RP11-56P10.3 | |
KIF12 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title