KIF13B Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP158258	100 μL

Catalog No. NBP158258 Supplier Novus Biologicals Supplier No. NBP158258

Description

Rabbit Polyclonal Antibody

KIF13B Polyclonal specifically detects KIF13B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: KIF13B
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q9NQT8
• Gene Alias: GAKIN, GAKINkinesin 13B, guanylate kinase associated kinesin, KIAA0639kinesin-like protein KIF13B, kinesin family member 13B, Kinesin-like protein GAKIN
• Gene Symbols: KIF13B
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to KIF13B(kinesin family member 13B) The peptide sequence was selected from the N terminal of KIF13B. Peptide sequence SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE.
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 23303
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 84%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only